Shipping Free Canada-Wide Shipping on Orders $300+
Canada Proudly Canadian
Lab tested Third-Party Lab Tested - 99% Purity Standards
Free Canada-Wide Shipping on Orders $300+
Proudly Canadian
Third-Party Lab Tested - 99% Purity Standards

VIP

VIP (Vasoactive Intestinal Peptide) is a naturally occurring peptide studied for its role in lung and respiratory function, circulation, immune signaling, nervous system communication, and tissue protection.

Also available as a VIP 10mg Nasal Spray Kit.

 

$109.99

- +
Add to Wishlist
Add to Wishlist

Peptide Name: VIP (Vasoactive Intestinal Peptide)
Molecular Formula: C147H237N43O43S
Molecular Weight: 3325.8 g/mol
Amino Acid Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
Form: Lyophilized powder
Quantity: 10 mg per vial
Purity: ≥99% (HPLC)
Appearance: White to off-white solid
Packaging: Sterile vial, sealed for research handling

Storage recommendations are provided as general laboratory guidelines and may vary depending on the peptide and storage conditions.

Lyophilized Vials

Before Reconstitution

  • Store at room temperature for up to 1 month, refrigerated at 2–8 °C for 1–12 months, or frozen at −20 °C for long-term storage.
  • Protect from light, heat, and moisture.
  • Avoid repeated freeze–thaw cycles.

After Reconstitution

  • Store refrigerated at 2–8 °C.
  • For best quality, use within 2–8 weeks, depending on the peptide and reconstitution solution.
  • Protect from light and heat.
  • Do not shake the vial.

Nasal Sprays

This kit is supplied as a lyophilized peptide and must be reconstituted with the included sterile water before use.

Before Reconstitution

  • Store refrigerated at 2–8 °C.
  • Protect from light.
  • Do not freeze.

After Reconstitution

  • Store refrigerated at 2–8 °C.
  • Protect from light.
  • Gently roll before each use. Do not shake.
  • Use within 30 days for optimal quality.
  • Discard any remaining solution after 30 days.
  • Keep out of reach of children.

This product is sold strictly for laboratory research purposes only and is not for human or veterinary use, consumption, administration, injection, or application of any kind.
This product is not a drug, natural health product, food, or cosmetic and has not been evaluated by Health Canada.
No medical advice is provided, and no representations or warranties are made regarding biological activity, safety, efficacy, or therapeutic outcomes.

The purchaser assumes full responsibility for regulatory compliance, proper handling, storage, disposal, and lawful use in accordance with all applicable local, provincial, and federal laws.

Add a review
VIP VIP
Rating*
0/5
* Rating is required
* Answer is required
Your review
* Review is required
Name
* Name is required
Add photos or video to your review
* Please tick the checkbox to proceed
* Please confirm that you are not a robot
5.0
Based on 45 reviews
5
100
100%
4
0%
3
0%
2
0%
1
0%
1-5 of 45 reviews

  1. City, Province Calgary Ab


    this has helped me so much with my eating & weight loss, have bought it twice & recommend it to anyone interested

  2. Works great.

  3. Great product works great. I recommend giving it a try. Down 17lbs in 2 months

  4. Another great purchase.

  5. Glad the nasal sprays are an option now! I’ll definitely order these ones again.